Bacterial taxon 243277
Locus VC_1847
Protein NP_231481.1
Holliday junction resolvase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 173 aa, Gene ruvC, UniProt Q9KR00
>NP_231481.1|Vibrio cholerae O1 biovar El Tor str. N16961|Holliday junction resolvase
MSVILGIDPGSRVTGYGVIRQQGRHLIYLGSGCIRTSDLELPLRLKQIYAGVSEIITQFQPDAFAIEQVFMAKNADSALKLGQARGSAIVAAVNAELPVYEYAARLIKQAVVGTGAADKSQVQHMVQQMLKLPGKPQADAADALGVAICHANTNKTLIALAGQATSARRGRYR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -3.88 | 9.8e-6 | ●●○○○ -1.38 | -1.3826718901167063 | 24331463 |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)