Bacterial taxon 243277
Locus VC_1611
Protein NP_231251.1
homoserine O-succinyltransferase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 319 aa, Gene metAS, UniProt Q9KRM5
>NP_231251.1|Vibrio cholerae O1 biovar El Tor str. N16961|homoserine O-succinyltransferase
MLREKAVPIRIPDQLPASDVLRNENIFVMSESRASTQEIRPLKVLLLNLMPKKIETETQFLRLLSNSPLQVDIELLRIDDRPSKNTPEEHLNTFYRQFELVKNRNFDGLIITGAPLGLVQFEDVAYWQHLQNIMAWAKAHVTSTLYICWAAQAGLKLLYNLPKRTREEKLSGVYYHDIHKPFHPLLRGFDDRFLAPHSRYADFDAEFLAEHTDLDILATSDVAGVYLAATKDKRNVFVTGHPEYDAYTLHGEYVRDLGEGLNPAIPVNYYPNDNPDNKPCASWRSHGHLLFANWLNYCVYQQTPYDLEKFSEANFTKDE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.87 | 4.7e-8 | ●○○○○ -0.46 | -0.4579572339593021 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)