Bacterial taxon 243277
Locus VC_0049
Protein NP_229708.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 158 aa, Gene smg, UniProt Q9KVU0
>NP_229708.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MMMDILMYLFETYVHSDADLQVDQDQLEDELLRAGFHQKDIYKALHWLEELAALQQTDAQTAIAKSAPTSMRIYAPEEIERLDLESRGFLLFLEHINVLTPETREMVIDRVMGLETDEFELDDLKWIILMVLFNVPGNENAYTVMEELLYSKEQGILH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2.52 | 0.0002 | ●○○○○ -0.76 | -0.7588830780182602 | 24331463 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)