Bacterial taxon 243277
Locus VC_0059
Protein NP_229718.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 46 aa, Gene n/a, UniProt Q9KVT0
>NP_229718.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MIQLGVLGREIANENKLKKVFDTTVYLAKMAASSEADCKEERSLTI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.75 | 0.00025 | ○○○○○ 0.75 | 0.7511545330407691 | 24331463 |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)