Bacterial taxon 243277
Locus VC_0114
Protein NP_229773.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 182 aa, Gene yihI, UniProt Q9KVM7
>NP_229773.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MSRSKKSRKPGTNSNDQLVVVRTRSESELESRLRKKLKKRKGLKSGSRHSEGSESQVRQAAQKRDPRLGSKKPIPLIVAEPKKLNKQERKLAAEQELAMLEKDAQLNVLLDRLDNGEKLGIGLQKYVDEKLDRIEVLMEQLGLLDDEPEPAPAPQSKPTKKRKTEDDLLSEFEQLDVDKYQD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.81 | 0.011 | ○○○○○ 0.78 | 0.7768469336478251 | 24331463 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)