Bacterial taxon 243277
Locus VC_0274
Protein NP_229930.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 244 aa, Gene n/a, UniProt Q9KV82
>NP_229930.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MLYTTPRLNISAFLFMKQQLSFLFLLSGLLAGCSSTPNPNLEQINQFTGGKTIGDATSFYWYTESFQKPSSASDYVTSGDYGSYQTSYRWEEGQVREIRREGEHLDGKKLVPFRVHIRFSKEGEAVYQQYRLGGKVLPMNEEQLAHYVLQAKAVAEATKEQDKQGLELIQGYWNGKTFETCQGVEYQRVEFNQSLPSFVFNRLASIESYVAFLGKIRNGKVHIDELLLLDDAGHDCVKEPELLD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.45 | 0.019 | ○○○○○ 0.61 | 0.6109340095982616 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)