Bacterial taxon 243277
Locus VC_0816
Protein NP_230465.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 60 aa, Gene n/a, UniProt Q9KTS2
>NP_230465.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MALSGSERLIKIHFVHLRQLFIYYEQPASLNKQLTPSSLSQLYIAKTIHPAHQQILTYNS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.06 | 0.029 | ●○○○○ -0.08 | -0.0846842163550785 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)