Bacterial taxon 243277
Locus VC_0952
Protein NP_230599.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 105 aa, Gene rsfS, UniProt Q9KTF0
>NP_230599.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MQGEALKDFLFDKADDMKAVDIVTLDVKEKSSVTDYMIVCTGTSKRHVASIAEHVANEAKLSGLQPLGMNGENEGEWVVLDMGSVMLHVMQEAPRELYQLEKLWG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.61 | 0.012 | ○○○○○ 0.12 | 0.12421269945411076 | 24331463 |
Retrieved 1 of 1 entries in 9.4 ms
(Link to these results)