Bacterial taxon 243277
Locus VC_1150
Protein NP_230795.2
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 169 aa, Gene n/a, UniProt Q9KSV6
>NP_230795.2|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MKRLSTVLLMSVVSASAYADNTCFSQKYDAYIDASLNWYADLTKLTSERNPDLAEVSQWFLEGRQHHFALNRAAVHYYLQHDPSKVATTQHVESWLKLEQPEIKQLATRSDELGKLASVTFADRQATPHPKNYELRSALADLLSHPKQIESALNRYNQAIEKVEAMKCQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.95 | 0.0087 | ●○○○○ -0.03 | -0.03178225169724866 | 24331463 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)