Bacterial taxon 243277
Locus VC_1435
Protein NP_231078.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 224 aa, Gene n/a, UniProt Q9KS26
>NP_231078.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MSPDYLGAWVVGLLGAGHCLGMCGGISALLTLDPSKSSPALLLYYNLGRLLSYALIGGIVGGITASLTELIDVQSALVWLRIFAAVLMIVLGLYIGRWWFGLLWLEKVGQKIWRWISPLGKTLLPLKKQWHALPFGLVWGWLPCGLVYSMLTWSAVAGSFSQGALIMLSFGFGTLPAMLASGWGANKLMHWQNSHLFRQCAAILVIGYGLFTAYDAVKLMINLG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.57 | 0.00034 | ○○○○○ 0.14 | 0.14248818781839886 | 24331463 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)