Bacterial taxon 243277
Locus VC_1465
Protein NP_231108.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 194 aa, Gene n/a, UniProt Q9KS07
>NP_231108.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MTKYVRLNNVGAAWIKSTREKYGLTTTQAAEMCCVSTQTWRRWENGSYPMNPCIFHYWLSVLEKRVLPRSGLEGKRWQGWYFDEGKLVTPLGHRLGAAQIEDQQNQINQTRAVYRQAHKVREHAKSGLHEAGESWFGWQFKGGFLVSPDERKIAADELYVMMVGYDAMTYAKAYKKPPIDTAKATVLNLETKCS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.37 | 0.044 | ○○○○○ 0.24 | 0.23607958454162606 | 24331463 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)