Bacterial taxon 243277
Locus VC_1555
Protein NP_231195.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 170 aa, Gene n/a, UniProt Q9KRT1
>NP_231195.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MWRLRASSINKETPMFIGHITQRQFCAALSPQLQRLINEVLQRVAAPLPTGKHELQGDSAFFLVMEDHTQPLALRRSECHARYLDVQILLQGRERFGYSLAPFSGLDEDLLATRDVAFSAQLVEERFVDLAAGDFIVFYPGQPHRPLIAVEGEGEPVRKVVIKVDKAFFE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2.35 | 4.1e-5 | ●○○○○ -0.68 | -0.677724893077169 | 24331463 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)