Bacterial taxon 243277
Locus VC_1733
Protein NP_231369.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 67 aa, Gene n/a, UniProt Q9KRA9
>NP_231369.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MLCFLAPLKVLVVMGRGENSSYPQTNQIHALALAFILLAMNFYFCLCNLDQAWDFPSIKIGKLHQNH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 1.08 | 0.017 | ○○○○○ 0.9 | 0.9007431155971647 | 24331463 |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)