Bacterial taxon 243277
Locus VC_1778
Protein NP_231413.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 173 aa, Gene siaQ, UniProt Q9KR65
>NP_231413.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MELKMLRKIINNIEEIITVPLMAALLAVLTWQIGTRWLLNDPSLWSEELARLLFMYMCLVGCAIAIKRSSHVNITFFSDKLPEKARLSLVLSLEIAVLVSIGAIIVLGYQHAQRNAFFELITLGISSSWMNYSLPVGGVFMVFRQLEKIFNLMKLLLGVSSSASLIDQQVTER
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.83 | 0.00095 | ○○○○○ 0.02 | 0.02082621538649866 | 24331463 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)