Bacterial taxon 243277
Locus VC_A0109
Protein NP_232510.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 145 aa, Gene n/a, UniProt Q9KN56
>NP_232510.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MTYIAPEESAFGVGFFERLEANAKPMSLTRGPDAWDVLESIKRNVSNILNTRIGGAQSAPHLGLVDFNDATLETLDLSVRIKLAIQQCLERYEPRLTRVLVRADQDSFNPLTLRFHITATINSEALHEKVQFSLLLDQSRKYRVF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.27 | 0.0062 | ●○○○○ -0.45 | -0.45262624453896394 | 24331463 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)