Bacterial taxon 243277
Locus VC_A0122
Protein NP_232523.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 80 aa, Gene n/a, UniProt Q9KN43
>NP_232523.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MIGARDCSVIRVNPGAKQGKVDKKLALSLPLTATQYFQRTIFNEPFSSNLRWPHIECYRRKKEQGKQHGKVTVSIKGGWP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -6.14 | 2.3e-11 | ●●●●○ -3.58 | -3.5762215143228397 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)