Bacterial taxon 243277
Locus VC_A0294
Protein NP_232690.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 124 aa, Gene n/a, UniProt Q9KMN4
>NP_232690.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MRCSPLNWALCGRRKIMNPSAVLVHVPDVAKGLEWYKKAFPEAVPVYHHDFDFTALDLNGFSLEIVQADKKVGAGKSGTVVYWSVDNLCVALANFEELGASLFVDQWKLKMGFQCAKLRTHLET
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.5 | 0.015 | ○○○○○ 0.69 | 0.6851563962634462 | 24331463 |
Retrieved 1 of 1 entries in 0.3 ms
(Link to these results)