Bacterial taxon 243277
Locus VC_A0298
Protein NP_232694.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 83 aa, Gene n/a, UniProt Q9K315
>NP_232694.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MELNTAIESRIIEMAWEDRTPFEAIKHQFGLNEAEVIKFMRSRLKPSSFKLWRGRVSGRNTKHAKLRSSEISRGYCPTQYKHR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.76 | 0.0022 | ○○○○○ 0.85 | 0.8509604438543192 | 24331463 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)