Bacterial taxon 243277
Locus VC_A0385
Protein NP_232779.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 111 aa, Gene n/a, UniProt Q9K3B3
>NP_232779.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MSVYLNMQNKQYKLSQLAQEHLLKIKHYTIENFAEAQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEANFILIVAVLGQSQLPQKHLKQSRFVS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.95 | 0.00018 | ●○○○○ -0.89 | -0.886921325616769 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)