Bacterial taxon 243277
Locus VC_A0445
Protein NP_232839.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 82 aa, Gene n/a, UniProt H9L4T4
>NP_232839.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MTTRILADVAASITEFKANPMKVATSAFGAPVAVLNRNEPAFYCVPASTYEIMMDKLEDLELLAIAKERLSEDSVSVNIDDL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -4.16 | 6.0e-10 | ●●●○○ -2.3 | -2.3049560967989318 | 24331463 |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)