Bacterial taxon 243277
Locus VC_A0467
Protein NP_232859.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 52 aa, Gene n/a, UniProt Q9KMA7
>NP_232859.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MTVPLEAFVMCVFLMPTLPFKGVAKGIYAKQHSIKSHHIHKTKMLHIDIFRP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.33 | 0.00016 | ●○○○○ -0.49 | -0.4889421781858224 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)