Bacterial taxon 243277
Locus VC_A0468
Protein NP_232860.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 110 aa, Gene higB-2, UniProt Q9KMA6
>NP_232860.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRKIRVASKGKGKRGGSRIIYYFLDEKRRFYLLTIYGKNEMSDLNANQRKQLMAFMEAWRNEQS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.87 | 0.0016 | ●○○○○ -0.19 | -0.19344401137345943 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)