Bacterial taxon 243277
Locus VC_A0489
Protein NP_232881.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 100 aa, Gene n/a, UniProt Q9KM92
>NP_232881.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKVRILFVMRAERDLRRLMLTKQ
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 1,95 | 0,014 | ○○○○○ 1,61 | 1.614562158408189 | 24331463 |
Retrieved 1 of 1 entries in 0,9 ms
(Link to these results)