Bacterial taxon 243277
Locus VC_A0580
Protein NP_232970.2
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 161 aa, Gene n/a, UniProt Q9KM09
>NP_232970.2|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MSHFYSFRTQAMSIWNKPISLEILNATSKNTLIEHLNIIYTEVTENSISATMPVCHFTHQPLGMLHGGASVVLAETLGSVAANFSVGEDAYCVGLDINANHVRAMREGLVTGTAVPLHIGVSTQVWQIEIKDEQGRLVCISRLTVAVKRSRPNQAKPVAEV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.47 | 0.0021 | ○○○○○ 0.06 | 0.0627522589415248 | 24331463 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)