Bacterial taxon 243277
Locus VC_A0649
Protein NP_233038.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 180 aa, Gene n/a, UniProt Q9KLU2
>NP_233038.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MLAVTTLAQPYRYSAAIHGCLETLEQGRDFLNTIGDDHYTYVAKPHVSSSIGQHFRHWLDIFHALCAAPNTVDYNQRRRGHPVELSRQVALKEIESLIAWLESDLLQSPQMAIDVVMEVSLSQTESCTFHSTLERELAFAALHANHHFAMAKVVTSLLNVQTPSDFGLAPATATFLRGNA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 1.06 | 0.0034 | ○○○○○ 1.05 | 1.0462747500541085 | 24331463 |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)