Bacterial taxon 243277
Locus VC_A1035
Protein NP_233418.2
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 82 aa, Gene n/a, UniProt Q9KKR6
>NP_233418.2|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MNNTTAKPTLPDRLSGNSRSPFFIKECFEHQIGIRFNGKERTDVEEYCISEGWIKIPSPKAKDRYGNPMLIQLKGTVEAYYV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.97 | 0.00069 | ○○○○○ 0.99 | 0.9871280598958969 | 24331463 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)