Bacterial taxon 243277
Locus VC_A1054
Protein NP_233436.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 212 aa, Gene n/a, UniProt Q9KKP8
>NP_233436.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MKVAILGASGWIGSHLAAEAKMRGHEVVAVVRDPAKVTLKGVAVQQLDILNPESSLKSVLEGVDAVIASIGGRAAGNHEMVAKTAQRLLNELPQAGVARLLWVGGAGSLEVAPGVKLVTVPGFPEEYKGEALAQGEALEVFRASNSDVNWTFVSPAAEIFPGDKQGQYRVGGDQLLTDSEGNSRISVADYAVALIDELEYAEHPRQRIGVAY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 1.21 | 0.0077 | ○○○○○ 1.14 | 1.1399266552090694 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)