Bacterial taxon 243277
Locus VC_1914
Protein NP_231548.1
integration host factor subunit beta
Vibrio cholerae O1 biovar El Tor str. N16961
Length 92 aa, Gene ihfB, UniProt Q9KQT4
>NP_231548.1|Vibrio cholerae O1 biovar El Tor str. N16961|integration host factor subunit beta
MTKSELIERLCAEQTHLSAKEIEDAVKNILEHMASTLEAGERIEIRGFGSFSLHYREPRVGRNPKTGDKVELEGKYVPHFKPGKELRERVNL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -6.69 | 2.0e-12 | ●●●○○ -2.68 | -2.6797987948347477 | 24331463 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)