Bacterial taxon 243277
Locus VC_A0202
Protein NP_232602.1
IS1004 transposase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 145 aa, Gene n/a, UniProt Q7DCS6
>NP_232602.1|Vibrio cholerae O1 biovar El Tor str. N16961|IS1004 transposase
MGDYRSSSHVYWRCKYHIVWTPKFRFKILKGNVAKELNRSIYILCNMKDCEVLELNVQPDHVHLVAIIPPKVSISTLMGVLKGRSAIRLFNKFPHIRKKLWGNHFWARGYFVDTVGVNEEIIRRYVRHQDKKELEQEQQLELLRD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -4.16 | 8.2e-6 | ●●●○○ -2.31 | -2.3057477176352683 | 24331463 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)