Bacterial taxon 243277
Locus VC_A0241
Protein NP_232639.1
L-xylulose 5-phosphate 3-epimerase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 294 aa, Gene n/a, UniProt Q9KMS9
>NP_232639.1|Vibrio cholerae O1 biovar El Tor str. N16961|L-xylulose 5-phosphate 3-epimerase
MYQHLLRHRVGLYEKALPNHLSWEEKLACTKELGFDFLEISVDESDERRSRLDWDDATIYSLHRLCEEYGVPLQSMCLSAHRKFPFGSADPALRDEALKIMQKAITLAYKLGIRTIQLAGYDVYYEPANSATHQRFIEGMQHAARLAERAGVMLAVEIMDTPYLNALSKFEVLNRQIQSPFFTAYPDVGNISGWNYDLLTELSLSKPHITQIHLKDTYKVSEQYAGQFRDLVIGEGDVDFDELFCRLKALDCVVPLVIEMWAHDEQWQQHIHTAQRRLNQACDRAELPRLFPHL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.64 | 0.012 | ●○○○○ -0.04 | -0.0443810885854261 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)