Bacterial taxon 243277
Locus VC_1010
Protein NP_230656.2
lactoylglutathione lyase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 138 aa, Gene gloA, UniProt Q9KT93
>NP_230656.2|Vibrio cholerae O1 biovar El Tor str. N16961|lactoylglutathione lyase
MSNHRILHTMLRVGDLDKSIEFYTQVMGMSLLRKNENTEYKYTLAFLGYGDESQGAVIELTYNWGVADYEKGNAYGHIAIGVDDIYATCDTIKAAGGIVTREPGPVKGGTTHIAFVKDPDGYMIELIQNKQAHAGLEG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.36 | 0.05 | ○○○○○ 0.57 | 0.5704992266149284 | 24331463 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)