Bacterial taxon 243277
Locus VC_A0776
Protein NP_233162.1
LamB/YcsF family protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 246 aa, Gene pxpA, UniProt Q9KLG8
>NP_233162.1|Vibrio cholerae O1 biovar El Tor str. N16961|LamB/YcsF family protein
MSKRTIQLNCDMGESFGVWTMGADEEVMPWIDMANIACGFHASDPHVMSRTIDLALEHEVMIGAHPSYPDLQGFGRRSLAMNEQEVSEIILYQVGALKALCESKNGQLSYVKPHGALYNDMMSDPSIFRAVVDAVSCFNLPLMVLASANNQDYLDIADRFDVPLLFEAFADRTYLANGKLTPRSQPNAVLSSEEAILNQVRQIARYGKVTSSDGFVIPIEADTLCVHGDNPNAVSLIARIRAALDE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.26 | 0.0094 | ○○○○○ 0.19 | 0.1940858366860757 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)