Bacterial taxon 243277
Locus VC_A0612
Protein NP_233001.1
large-conductance mechanosensitive channel
Vibrio cholerae O1 biovar El Tor str. N16961
Length 136 aa, Gene mscL, UniProt Q9KLX9
>NP_233001.1|Vibrio cholerae O1 biovar El Tor str. N16961|large-conductance mechanosensitive channel
MSLLKEFKAFASRGNVIDMAVGIIIGAAFGKIVSSFVADIIMPPIGIILGGVNFSDLSFVLLAAQGDAPAVVIAYGKFIQTVVDFTIIAFAIFMGLKAINSLKRKEEEAPKAPPAPTKDQELLSEIRDLLKAQQDK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.53 | 0.004 | ○○○○○ 0.02 | 0.021684735770694723 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)