Bacterial taxon 243277
Locus VC_0092
Protein NP_229751.1
LexA repressor
Vibrio cholerae O1 biovar El Tor str. N16961
Length 209 aa, Gene lexA, UniProt Q9KVP9
>NP_229751.1|Vibrio cholerae O1 biovar El Tor str. N16961|LexA repressor
MKPLTPRQQEVFDLIKSKIDETGMPPTRAEIAKELGFRSANAAEEHLKALARKQVIEMVPGASRGIRILVDNAANEEEAETGLPLIGRVAAGEPILAQEHVEAHYQVDPSMFRPQADFLLRVHGESMKNIGILDGDLLAVHKTQDVRNGQVVVARVEDDVTVKRLERKGSKVFLHAENEEFAPIEVDLAAQSLTIEGIAVGVIRNSTWM
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -5.24 | 4.0e-7 | ●●●○○ -2.01 | -2.012239895129191 | 24331463 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)