Bacterial taxon 243277
Locus VC_0224
Protein NP_229881.1
lipopolysaccharide biosynthesis glycosyltransferase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 259 aa, Gene n/a, UniProt Q9KVC2
>NP_229881.1|Vibrio cholerae O1 biovar El Tor str. N16961|lipopolysaccharide biosynthesis glycosyltransferase
MSKPTLAVALIVKNEARHLDECLQTVHDWVDEIVVLDSGSHDETEQVARRYTEKFYVNAKWPGFGLQRQLAQSYVQSDYVLWLDADERVTPELKQSILQAVAANKPDTLYQFARLSWVFGRFIRHSGWYPDRVLRLYPTQLTRYNDALVHEKVHVEPSMKVETLAGDAIHYTYNDVHHYLVKSAGYAKAWADQRQAKGKKASLSQGIVHAVGCFLKMYLLKRGFLDGKQGFLIALLSAHSTFVKYADLWARDNDEHYKR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -5.86 | 2.4e-7 | ●●●○○ -2.3 | -2.296525009407863 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)