Bacterial taxon 243277
Locus VC_A0350
Protein NP_232746.1
lipoprotein Blc
Vibrio cholerae O1 biovar El Tor str. N16961
Length 171 aa, Gene n/a, UniProt Q9KMJ6
>NP_232746.1|Vibrio cholerae O1 biovar El Tor str. N16961|lipoprotein Blc
MRAIFLILCSVLLNGCLGMPESVKPVSDFELNNYLGKWYEVARLDHSFEKGLSQVTAEYRVRNDGGILVLNRGYSEEKGEWKEAEGKAYFVNGSTDGYLKVSFFGPFYGSYVVFELDRENYSYAFVSGPNTEYLWLLSRTPTVERGILDKFIEMSKERGFDTNRLIYVQQQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.63 | 0.0017 | ●○○○○ -0.04 | -0.04083423468478403 | 24331463 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)