Bacterial taxon 243277
Locus VC_0683
Protein NP_230332.1
lipoprotein signal peptidase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 171 aa, Gene lspA, UniProt Q9KU46
>NP_230332.1|Vibrio cholerae O1 biovar El Tor str. N16961|lipoprotein signal peptidase
MSNSSLALKQSGLRWLWLALLVFIADITIKLIVMDNMGYGWANRIEVLPFFNLLYVHNYGAAFSFLSDQEGWQRWLFTGIAFVVTGMLAYWMRRLPASDKWNNIAYALIIGGAVGNVFDRIVHGFVVDYLDFYWGTYHWPAFNLADSTICIGAAMIILDGFRAKKSAPSQS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.93 | 0.0013 | ●○○○○ -0.03 | -0.02574427182232002 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)