Bacterial taxon 243277
Locus VC_1064
Protein NP_230709.1
lipoprotein-like protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 143 aa, Gene n/a, UniProt Q9KT41
>NP_230709.1|Vibrio cholerae O1 biovar El Tor str. N16961|lipoprotein-like protein
MKKVLLIVISILFGSVLVGCQMNESNKTQDKIQSITGSVAYRERIALPDNAVVTVYLQDVSLADAPATVIAKQNFITNGMQVPLEFNLAYDSRKIKASHRYSVSARIEVDGKLRFITDTHYGVITDPEATKHVPMMLIGVHGE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -5.58 | 3.4e-11 | ●●●○○ -2.17 | -2.1705164031586497 | 24331463 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)