Bacterial taxon 243277
Locus VC_1617
Protein NP_231257.1
LysR family transcriptional regulator
Vibrio cholerae O1 biovar El Tor str. N16961
Length 296 aa, Gene n/a, UniProt Q9KRL9
>NP_231257.1|Vibrio cholerae O1 biovar El Tor str. N16961|LysR family transcriptional regulator
MRYTGYMMEVRQLRHFVTVAEWESFTLAAQQLHIAQPALSISIKKFEQQLGVTLFKRDERKVALTHEGEVLLEHAKRILQQVNDAQLAVDELKGVVKGEVRLGAPSMMGSYFFPQIIMAFKSHFPNLKMTVIEAGTQSIRRMLLSGELDIGVILNHDLPDDLAADPLLSSQMVAVVGKNHELAERRHLTFAEFFEHELVMFKPGYFHRDFIDKVCREHKFTADFSFETNLLPMILSIVKHEYAITALLELVTSNEPEVKAIPFEPPVWLDLALAWRKEGYLSNADRTFIEFVKKYV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2.3 | 1.4e-8 | ●○○○○ -0.66 | -0.6567592521704311 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)