Bacterial taxon 243277
Locus VC_A0946
Protein NP_233330.1
maltose/maltodextrin transporter ATP-binding protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 373 aa, Gene malK, UniProt Q9KL04
>NP_233330.1|Vibrio cholerae O1 biovar El Tor str. N16961|maltose/maltodextrin transporter ATP-binding protein
MASVTLKNVCKAYGDVLISKNVDLEIQEGEFVVFVGPSGCGKSTLLRCIAGLEDITSGDLYIGEQRMNDVEPSKRGVGMVFQSYALYPHLNLYDNMSFGLKLSKADKSEIKKRVDHAAEILQLSHLLDRQPKALSGGQRQRVAIGRTLVSQPNVFLLDEPLSNLDAALRVQMRSEITKLQRKLGCTMIYVTHDQVEAMTMADKIVVLDAGFVSQVGKPLELYHYPQNRFVAGFIGSPKMNFMSVFIEGVEKDRVQVQLSNGTTFWIPVDGTTVTRGERMSLGIRPEHLVEAEHGDAKIEGKVMIVEKLGNETQVYMNLKGSDSDVIYRQPDTLDVETGDTLTIGIPAHRCHLFHSDGRACRRLHKEKGVDLPA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.36 | 0.026 | ○○○○○ 0.13 | 0.13258862106175673 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)