Bacterial taxon 243277
Locus VC_A1005
Protein NP_233389.1
MarR family transcriptional regulator
Vibrio cholerae O1 biovar El Tor str. N16961
Length 152 aa, Gene n/a, UniProt Q9KKU5
>NP_233389.1|Vibrio cholerae O1 biovar El Tor str. N16961|MarR family transcriptional regulator
MPSPQVSCQTPTHDPLLLENQVCFPLYSASNAVIRAYRPLLEQLDITYSQYLVLLVLWQQNGINVKDLGIKLHLDSGTLTPLLKRLEAKGIVERRRSSSDERVRELFLTPAGFALQEQARSVPNEMLCKFDLSLEELISLKTLCEKILHTLD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.93 | 1.1e-5 | ○○○○○ 0.96 | 0.9625779135773437 | 24331463 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)