Bacterial taxon 243277
Locus VC_0974
Protein NP_230621.1
MerR family transcriptional regulator
Vibrio cholerae O1 biovar El Tor str. N16961
Length 139 aa, Gene cueR, UniProt P0C6D2
>NP_230621.1|Vibrio cholerae O1 biovar El Tor str. N16961|MerR family transcriptional regulator
MNISQIAKLTSLTAKSIRLYEEKGLIIPPLRSESGYRTYTQQHVDDLLLIARCRRVGFSLDECKAMLTLANDPNRTSAAVRARAQEKWQEISRKLSELTMIKQQLEEWIASCPGDQGSDCPIIEQLKGHCCSNNKTKTP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.49 | 0.015 | ○○○○○ 0.63 | 0.6322836238690753 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)