Bacterial taxon 243277
Locus VC_A0056
Protein NP_232457.1
MerR family transcriptional regulator
Vibrio cholerae O1 biovar El Tor str. N16961
Length 265 aa, Gene n/a, UniProt Q9KNA9
>NP_232457.1|Vibrio cholerae O1 biovar El Tor str. N16961|MerR family transcriptional regulator
MVCDEKRYAIREVAEITGVKPVTLRAWQRRYNLVQPDRTEKGHRLFTDQDIEMIRQIQSWLAKGVAIGKVGALLQSGVSESESIPQPVGQLEECETLLTALAALQRSKAEQIIATVLKEYPLSVMQAQFVQPVTEALERVKGPLRSLQIGLFRTLMLSKLAFILDAENKAAVKGKCLCISLDEAGSLNAWLWALAWAENGHQVTLLEAVDDIRGLLENPGLAQYQILALHAHRALPAAQQSALASLQQQFGEQCVLSNVLQQLQS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2.78 | 4.4e-5 | ●●○○○ -1.42 | -1.4229098045328978 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)