Bacterial taxon 243277
Locus VC_1717
Protein NP_231353.1
metallothionein SmtA
Vibrio cholerae O1 biovar El Tor str. N16961
Length 260 aa, Gene cmoM, UniProt Q9KRC5
>NP_231353.1|Vibrio cholerae O1 biovar El Tor str. N16961|metallothionein SmtA
MTEDRNFDDIAHKFAKNIYGSDKGEIRQVIVWEDLEQLLSQLDTQKVPLHVLDAGGGLAQVSQKIARLGHRVTLCDLSSEMLQLAEQDIANNGLLEQYRFVHSPVQTIQAHLDAPVDLVLFHAVMEWLAEPKPALQNLLAQVRPGGMVSVMFYNYHGLVYKNAVCGNIPHVLEDMPHRKRFKLQPQKGLLPEEVYQWIEESSFEICGKSGIRCFSDYIGNMKNMGEYQYEDLVALERKFCRQEPYLSLGRYIHVWAKKKQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.43 | 1.1e-7 | ●○○○○ -0.26 | -0.2558816647661065 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)