Bacterial taxon 243277
Locus VC_1998
Protein NP_231632.1
methionine sulfoxide reductase B
Vibrio cholerae O1 biovar El Tor str. N16961
Length 147 aa, Gene msrB, UniProt Q9KQK0
>NP_231632.1|Vibrio cholerae O1 biovar El Tor str. N16961|methionine sulfoxide reductase B
MVSEAISKKEIERVKFESKDLHKPDEYWREHLTEEAFYVCRQQGTEAPYSGKLLHNKDTGLYHCTCCQSALFSSENKYDSGCGWPSFDAPINEQVIRFLDDFSHGMVRTEIRCAACDSHLGHVFEDGPKTTGLRFCVNSVSLIFNKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.66 | 0.006 | ○○○○○ 0.1 | 0.10011190554824421 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)