Bacterial taxon 243277
Locus VC_1065
Protein NP_230710.1
methylated-DNA--protein-cysteine methyltransferase-like protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 100 aa, Gene n/a, UniProt Q9KT40
>NP_230710.1|Vibrio cholerae O1 biovar El Tor str. N16961|methylated-DNA--protein-cysteine methyltransferase-like protein
MDQFLQQIFVVIHQIPVGRVSTYGAIAKMAGYPGYARHVGKALGHLPEGSQLPWFRVINSQGKISLQGEDFVRQRQLLLAEGIEVSDTGKISLRKYQWQL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -0.35 | 0.011 | ○○○○○ 0.25 | 0.2450714663868422 | 24331463 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)