Bacterial taxon 243277
Locus VC_A0711
Protein NP_233098.1
methylglyoxal synthase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 151 aa, Gene mgsA, UniProt Q9KLN2
>NP_233098.1|Vibrio cholerae O1 biovar El Tor str. N16961|methylglyoxal synthase
MKKTTRTMAAHKHVALVAHDNCKGELLRWVTENKEKLQRHFLYATGTTGHMLSKETGLAIKSMISGPMGGDQQLGALISEGKIDVLIFFWDPLNAVPHDPDVKALLRIASVWNIPVATNRASAKFLFSSSLMEQEVQIEIPDYQAYLAERT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.73 | 0.023 | ●○○○○ -0.75 | -0.7504383059119882 | 24331463 |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)