Bacterial taxon 243277
Locus VC_1796
Protein NP_231431.1
middle operon regulator-like protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 124 aa, Gene n/a, UniProt Q9KR50
>NP_231431.1|Vibrio cholerae O1 biovar El Tor str. N16961|middle operon regulator-like protein
MLAIERAIPLVVDALSKDSGLFSFDDLESGDALYPELLSDVHDIFLGVIEDAGIEDNGLALHLVFKLMEYGNGVQFYLPKPDSIVKTIIKKMMKNDFNGSNYVELAKRYQCSTNHVRRVINGTH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -1.21 | 0.0067 | ●○○○○ -0.15 | -0.15383639828002782 | 24331463 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)