Bacterial taxon 243277
Locus VC_1025
Protein NP_230670.1
molybdenum cofactor biosynthesis protein B
Vibrio cholerae O1 biovar El Tor str. N16961
Length 170 aa, Gene n/a, UniProt Q9KT80
>NP_230670.1|Vibrio cholerae O1 biovar El Tor str. N16961|molybdenum cofactor biosynthesis protein B
MGHAESKFQAANIAVLTVSDTRTEENDTSGRYLAEQLQEAGHTLADKQIVIDDMYKIRAVVSQWIADETIQAILITGGTGFTSRDSTPEALKPLFDKEVEGFGELFRMVSFEEIGTSTIQSRAVAGFANHTVIFAMPGSTGACRTGWTKIIKQQLDASHRPCNFMPHLTV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -6.03 | 6.5e-10 | ●●●○○ -2.38 | -2.375382697231841 | 24331463 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)