Bacterial taxon 243277
Locus VC_1027
Protein NP_230672.1
molybdopterin synthase small subunit
Vibrio cholerae O1 biovar El Tor str. N16961
Length 81 aa, Gene n/a, UniProt Q9KT78
>NP_230672.1|Vibrio cholerae O1 biovar El Tor str. N16961|molybdopterin synthase small subunit
MIKVLFFAQTRELVECDSLVVDHAFATVEALRQHLAQQPGKWDMALEPGKLLAAVNQSIVPFDTELQDGDEVAFFPPVTGG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2.41 | 1.6e-7 | ●○○○○ -0.71 | -0.7077493068099495 | 24331463 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)